Anti-TXLNG
Artikelnummer:
ATA-HPA000297
- Bilder (8)
| Artikelname: | Anti-TXLNG |
| Artikelnummer: | ATA-HPA000297 |
| Hersteller Artikelnummer: | HPA000297 |
| Alternativnummer: | ATA-HPA000297-100,ATA-HPA000297-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX |
| taxilin gamma |
| Anti-TXLNG |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55787 |
| UniProt: | Q9NUQ3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TXLNG |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA000297-100ul |
|
|
|
|
|
HPA000297-100ul |
|
|
HPA000297-100ul |
Produktgarantie und fachkundiger Support
