Anti-TXLNG
Catalog Number:
ATA-HPA000297
- Images (8)
| Article Name: | Anti-TXLNG |
| Biozol Catalog Number: | ATA-HPA000297 |
| Supplier Catalog Number: | HPA000297 |
| Alternative Catalog Number: | ATA-HPA000297-100,ATA-HPA000297-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX |
| taxilin gamma |
| Anti-TXLNG |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 55787 |
| UniProt: | Q9NUQ3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TXLNG |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA000297-100ul |
|
|
|
|
|
HPA000297-100ul |
|
|
HPA000297-100ul |
Product Guarantee and Expert Support
