Anti-CTAGE5

Artikelnummer: ATA-HPA000387
Artikelname: Anti-CTAGE5
Artikelnummer: ATA-HPA000387
Hersteller Artikelnummer: HPA000387
Alternativnummer: ATA-HPA000387-100,ATA-HPA000387-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
CTAGE family, member 5
Anti-CTAGE5
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4253
UniProt: O15320
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CTAGE5
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human kidney shows weak granular positivity in cytoplasm in cells in tubules.
Immunohistochemical staining of human upper gastrointestinal shows moderate granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human skin shows low positivity in squamous epithelial cells as expected.
Western blot analysis in human cell line CAPAN-2.
HPA000387-100ul
HPA000387-100ul
HPA000387-100ul