Anti-CTAGE5 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA000387
- Images (9)
| Article Name: | Anti-CTAGE5 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA000387 |
| Supplier Catalog Number: | HPA000387 |
| Alternative Catalog Number: | ATA-HPA000387-100,ATA-HPA000387-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6 |
| CTAGE family, member 5 |
| Anti-CTAGE5 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 4253 |
| UniProt: | O15320 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CTAGE5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows weak granular positivity in cytoplasm in cells in tubules. |
|
|
Immunohistochemical staining of human upper gastrointestinal shows moderate granular positivity in cytoplasm in glandular cells. |
|
|
Immunohistochemical staining of human skin shows low positivity in squamous epithelial cells as expected. |
|
|
Western blot analysis in human cell line CAPAN-2. |
|
|
HPA000387 |
|
|
|
|
|
HPA000387 |
|
|
HPA000387 |
Product Guarantee and Expert Support
