Anti-CTAGE5

Catalog Number: ATA-HPA000387
Article Name: Anti-CTAGE5
Biozol Catalog Number: ATA-HPA000387
Supplier Catalog Number: HPA000387
Alternative Catalog Number: ATA-HPA000387-100,ATA-HPA000387-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
CTAGE family, member 5
Anti-CTAGE5
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4253
UniProt: O15320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CTAGE5
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human kidney shows weak granular positivity in cytoplasm in cells in tubules.
Immunohistochemical staining of human upper gastrointestinal shows moderate granular positivity in cytoplasm in glandular cells.
Immunohistochemical staining of human skin shows low positivity in squamous epithelial cells as expected.
Western blot analysis in human cell line CAPAN-2.
HPA000387-100ul
HPA000387-100ul
HPA000387-100ul