Anti-SLITRK4

Artikelnummer: ATA-HPA000431
Artikelname: Anti-SLITRK4
Artikelnummer: ATA-HPA000431
Hersteller Artikelnummer: HPA000431
Alternativnummer: ATA-HPA000431-100,ATA-HPA000431-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp547M2010
SLIT and NTRK-like family, member 4
Anti-SLITRK4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 139065
UniProt: Q8IW52
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHACGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLITRK4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human adrenal gland and colon tissues using Anti-SLITRK4 antibody. Corresponding SLITRK4 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
HPA000431-100ul
HPA000431-100ul
HPA000431-100ul