Anti-SLITRK4
Catalog Number:
ATA-HPA000431
- Images (6)
| Article Name: | Anti-SLITRK4 |
| Biozol Catalog Number: | ATA-HPA000431 |
| Supplier Catalog Number: | HPA000431 |
| Alternative Catalog Number: | ATA-HPA000431-100,ATA-HPA000431-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZp547M2010 |
| SLIT and NTRK-like family, member 4 |
| Anti-SLITRK4 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 139065 |
| UniProt: | Q8IW52 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PDCGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHACGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLITRK4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human adrenal gland and colon tissues using Anti-SLITRK4 antibody. Corresponding SLITRK4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland shows high expression. |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
HPA000431-100ul |
|
|
HPA000431-100ul |
|
|
HPA000431-100ul |
Product Guarantee and Expert Support
