Anti-GNPDA1
Artikelnummer:
ATA-HPA000499
- Bilder (6)
| Artikelname: | Anti-GNPDA1 |
| Artikelnummer: | ATA-HPA000499 |
| Hersteller Artikelnummer: | HPA000499 |
| Alternativnummer: | ATA-HPA000499-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GNPDA, GNPI, GPI, HLN, KIAA0060 |
| glucosamine-6-phosphate deaminase 1 |
| Anti-GNPDA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10007 |
| UniProt: | P46926 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GNPDA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in germ cells. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 |
|
|
HPA000499-100ul |
|
|
HPA000499-100ul |
|
|
HPA000499-100ul |
Produktgarantie und fachkundiger Support
