Anti-GNPDA1

Catalog Number: ATA-HPA000499
Article Name: Anti-GNPDA1
Biozol Catalog Number: ATA-HPA000499
Supplier Catalog Number: HPA000499
Alternative Catalog Number: ATA-HPA000499-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GNPDA, GNPI, GPI, HLN, KIAA0060
glucosamine-6-phosphate deaminase 1
Anti-GNPDA1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10007
UniProt: P46926
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GNPDA1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in germ cells.
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17
Lane 2: Human cell line RT-4
HPA000499-100ul
HPA000499-100ul
HPA000499-100ul