Anti-TYMP
Artikelnummer:
ATA-HPA000530
- Bilder (6)
| Artikelname: | Anti-TYMP |
| Artikelnummer: | ATA-HPA000530 |
| Hersteller Artikelnummer: | HPA000530 |
| Alternativnummer: | ATA-HPA000530-100,ATA-HPA000530-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ECGF1, MNGIE |
| thymidine phosphorylase |
| Anti-TYMP |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 1890 |
| UniProt: | P19971 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TYMP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to nuclear bodies & the Golgi apparatus. |
|
|
Western blot analysis in human cell lines A-431 and Caco-2 using Anti-TYMP antibody. Corresponding TYMP RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue. |
|
|
HPA000530-100ul |
|
|
HPA000530-100ul |
|
|
HPA000530-100ul |
Produktgarantie und fachkundiger Support
