Anti-TYMP
Catalog Number:
ATA-HPA000530
- Images (6)
| Article Name: | Anti-TYMP |
| Biozol Catalog Number: | ATA-HPA000530 |
| Supplier Catalog Number: | HPA000530 |
| Alternative Catalog Number: | ATA-HPA000530-100,ATA-HPA000530-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ECGF1, MNGIE |
| thymidine phosphorylase |
| Anti-TYMP |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 1890 |
| UniProt: | P19971 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TYMP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SiHa shows localization to nuclear bodies & the Golgi apparatus. |
|
|
Western blot analysis in human cell lines A-431 and Caco-2 using Anti-TYMP antibody. Corresponding TYMP RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human cell line A-431, human liver tissue and human tonsil tissue. |
|
|
HPA000530-100ul |
|
|
HPA000530-100ul |
|
|
HPA000530-100ul |
Product Guarantee and Expert Support
