Anti-HMOX1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000635
Artikelname: Anti-HMOX1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000635
Hersteller Artikelnummer: HPA000635
Alternativnummer: ATA-HPA000635-100,ATA-HPA000635-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bK286B10, HO-1
heme oxygenase (decycling) 1
Anti-HMOX1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3162
UniProt: P09601
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HMOX1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and salivary gland tissues using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human salivary gland shows low expression as expected.
Immunohistochemical staining of human spleen shows high expression.
Western blot analysis in human cell lines A-549 and MCF-7 using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and HMOX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400777).
HPA000635
HPA000635
HPA000635