Anti-HMOX1

Catalog Number: ATA-HPA000635
Article Name: Anti-HMOX1
Biozol Catalog Number: ATA-HPA000635
Supplier Catalog Number: HPA000635
Alternative Catalog Number: ATA-HPA000635-100,ATA-HPA000635-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bK286B10, HO-1
heme oxygenase (decycling) 1
Anti-HMOX1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 3162
UniProt: P09601
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: HMOX1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and salivary gland tissues using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human salivary gland shows low expression as expected.
Immunohistochemical staining of human spleen shows high expression.
Western blot analysis in human cell lines A-549 and MCF-7 using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western blot analysis in control (vector only transfected HEK293T lysate) and HMOX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400777).
HPA000635-100ul
HPA000635-100ul
HPA000635-100ul