Anti-HMOX1

Product Overview

• Article Name: Anti-HMOX1
• Biozol Catalog Number: ATA-HPA000635
• Supplier Catalog Number: HPA000635
• Alternative Catalog Number: ATA-HPA000635-100,ATA-HPA000635-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bK286B10, HO-1

Product Description

heme oxygenase (decycling) 1

Additional Information

Anti-HMOX1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 3162
• UniProt: P09601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: HMOX1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human spleen and salivary gland tissues using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human salivary gland shows low expression as expected.

Immunohistochemical staining of human spleen shows high expression.

Western blot analysis in human cell lines A-549 and MCF-7 using Anti-HMOX1 antibody. Corresponding HMOX1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Western blot analysis in control (vector only transfected HEK293T lysate) and HMOX1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400777).

HPA000635-100ul

HPA000635-100ul

HPA000635-100ul