Anti-DICER1
Artikelnummer:
ATA-HPA000694
- Bilder (7)
| Artikelname: | Anti-DICER1 |
| Artikelnummer: | ATA-HPA000694 |
| Hersteller Artikelnummer: | HPA000694 |
| Alternativnummer: | ATA-HPA000694-100,ATA-HPA000694-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1 |
| dicer 1, ribonuclease type III |
| Anti-DICER1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23405 |
| UniProt: | Q9UPY3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DICER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil. |
|
|
Immunohistochemical staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans, while exocrine cells are mainly negative. |
|
|
HPA000694-100ul |
|
|
HPA000694-100ul |
|
|
HPA000694-100ul |
Produktgarantie und fachkundiger Support
