Anti-DICER1
Catalog Number:
ATA-HPA000694
- Images (7)
| Article Name: | Anti-DICER1 |
| Biozol Catalog Number: | ATA-HPA000694 |
| Supplier Catalog Number: | HPA000694 |
| Alternative Catalog Number: | ATA-HPA000694-100,ATA-HPA000694-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Dicer, HERNA, K12H4.8-LIKE, KIAA0928, MNG1 |
| dicer 1, ribonuclease type III |
| Anti-DICER1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 23405 |
| UniProt: | Q9UPY3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DICER1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human endometrium shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human cerebellum shows moderate positivity in neuropil. |
|
|
Immunohistochemical staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans, while exocrine cells are mainly negative. |
|
|
HPA000694-100ul |
|
|
HPA000694-100ul |
|
|
HPA000694-100ul |
Product Guarantee and Expert Support
