Anti-ZBTB33

Artikelnummer: ATA-HPA000755
Artikelname: Anti-ZBTB33
Artikelnummer: ATA-HPA000755
Hersteller Artikelnummer: HPA000755
Alternativnummer: ATA-HPA000755-100,ATA-HPA000755-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
zinc finger and BTB domain containing 33
Anti-ZBTB33
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10009
UniProt: Q86T24
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ZBTB33
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemical staining of human gallbladder shows nuclear positivity in glandular cells.
Western blot analysis in human cell line RT-4, human cell line EFO-21, human cell line A-431, human liver tissue and human tonsil tissue.
HPA000755-100ul
HPA000755-100ul
HPA000755-100ul