Anti-ZBTB33

Catalog Number: ATA-HPA000755
Article Name: Anti-ZBTB33
Biozol Catalog Number: ATA-HPA000755
Supplier Catalog Number: HPA000755
Alternative Catalog Number: ATA-HPA000755-100,ATA-HPA000755-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: kaiso, WUGSC:H_DJ525N14.1, ZNF-kaiso, ZNF348
zinc finger and BTB domain containing 33
Anti-ZBTB33
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10009
UniProt: Q86T24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IAELGVPLSQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEMKKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ZBTB33
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cytosol.
Immunohistochemical staining of human gallbladder shows nuclear positivity in glandular cells.
Western blot analysis in human cell line RT-4, human cell line EFO-21, human cell line A-431, human liver tissue and human tonsil tissue.
HPA000755-100ul
HPA000755-100ul
HPA000755-100ul