Anti-SRGN Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA000759
Artikelname: Anti-SRGN Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA000759
Hersteller Artikelnummer: HPA000759
Alternativnummer: ATA-HPA000759-100,ATA-HPA000759-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PPG, PRG, PRG1
serglycin
Anti-SRGN
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5552
UniProt: P10124
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SRGN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and liver tissues using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines A-549 and Caco-2 using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line HL-60.
HPA000759
HPA000759
HPA000759