Anti-SRGN Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA000759
Article Name: Anti-SRGN Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA000759
Supplier Catalog Number: HPA000759
Alternative Catalog Number: ATA-HPA000759-100,ATA-HPA000759-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PPG, PRG, PRG1
serglycin
Anti-SRGN
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5552
UniProt: P10124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SRGN
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human bone marrow and liver tissues using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Western blot analysis in human cell lines A-549 and Caco-2 using Anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Western blot analysis in human cell line HL-60.
HPA000759
HPA000759
HPA000759