Anti-ELFN2
Artikelnummer:
ATA-HPA000781
- Bilder (8)
| Artikelname: | Anti-ELFN2 |
| Artikelnummer: | ATA-HPA000781 |
| Hersteller Artikelnummer: | HPA000781 |
| Alternativnummer: | ATA-HPA000781-100,ATA-HPA000781-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ63G5.3, KIAA1904, LRRC62, PPP1R29 |
| extracellular leucine-rich repeat and fibronectin type III domain containing 2 |
| Anti-ELFN2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 114794 |
| UniProt: | Q5R3F8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ELFN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Western blot analysis in human cerebral cortex tissue. |
|
|
|
|
|
|
|
|
HPA000781-100ul |
|
|
HPA000781-100ul |
|
|
HPA000781-100ul |
Produktgarantie und fachkundiger Support
