Anti-ELFN2
Catalog Number:
ATA-HPA000781
- Images (8)
| Article Name: | Anti-ELFN2 |
| Biozol Catalog Number: | ATA-HPA000781 |
| Supplier Catalog Number: | HPA000781 |
| Alternative Catalog Number: | ATA-HPA000781-100,ATA-HPA000781-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | dJ63G5.3, KIAA1904, LRRC62, PPP1R29 |
| extracellular leucine-rich repeat and fibronectin type III domain containing 2 |
| Anti-ELFN2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 114794 |
| UniProt: | Q5R3F8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ELFN2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Western blot analysis in human cerebral cortex tissue. |
|
|
|
|
|
|
|
|
HPA000781-100ul |
|
|
HPA000781-100ul |
|
|
HPA000781-100ul |
Product Guarantee and Expert Support
