Anti-CCDC117
Artikelnummer:
ATA-HPA000826
- Bilder (7)
| Artikelname: | Anti-CCDC117 |
| Artikelnummer: | ATA-HPA000826 |
| Hersteller Artikelnummer: | HPA000826 |
| Alternativnummer: | ATA-HPA000826-100,ATA-HPA000826-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ33814 |
| coiled-coil domain containing 117 |
| Anti-CCDC117 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 150275 |
| UniProt: | Q8IWD4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CCDC117 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, cytosol & microtubules. |
|
|
Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA000826-100ul |
|
|
|
|
|
HPA000826-100ul |
|
|
HPA000826-100ul |
Produktgarantie und fachkundiger Support
