Anti-CCDC117
Catalog Number:
ATA-HPA000826
- Images (7)
| Article Name: | Anti-CCDC117 |
| Biozol Catalog Number: | ATA-HPA000826 |
| Supplier Catalog Number: | HPA000826 |
| Alternative Catalog Number: | ATA-HPA000826-100,ATA-HPA000826-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ33814 |
| coiled-coil domain containing 117 |
| Anti-CCDC117 |
| Clonality: | Polyclonal |
| Concentration: | 0.8 mg/ml |
| Isotype: | IgG |
| NCBI: | 150275 |
| UniProt: | Q8IWD4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GHGVNPSVSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC117 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, cytosol & microtubules. |
|
|
Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in cortical cells. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA000826-100ul |
|
|
|
|
|
HPA000826-100ul |
|
|
HPA000826-100ul |
Product Guarantee and Expert Support
