Anti-PSMC1
Artikelnummer:
ATA-HPA000872
| Artikelname: |
Anti-PSMC1 |
| Artikelnummer: |
ATA-HPA000872 |
| Hersteller Artikelnummer: |
HPA000872 |
| Alternativnummer: |
ATA-HPA000872-100,ATA-HPA000872-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Sonstiges |
| Applikation: |
ICC, IHC, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
p56, S4 |
| proteasome (prosome, macropain) 26S subunit, ATPase, 1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
5700 |
| UniProt: |
P62191 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
PSMC1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. |
|
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts. |
|
Western blot analysis in human cell line EFO-21. |
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
HPA000872-100ul |
|
|
|
|
|
HPA000872-100ul |
|
HPA000872-100ul |