Anti-PSMC1

Catalog Number: ATA-HPA000872
Article Name: Anti-PSMC1
Biozol Catalog Number: ATA-HPA000872
Supplier Catalog Number: HPA000872
Alternative Catalog Number: ATA-HPA000872-100,ATA-HPA000872-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: p56, S4
proteasome (prosome, macropain) 26S subunit, ATPase, 1
Anti-PSMC1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5700
UniProt: P62191
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PSMC1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Western blot analysis in human cell line EFO-21.
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
HPA000872-100ul
HPA000872-100ul
HPA000872-100ul