Anti-STAT1

Artikelnummer: ATA-HPA000931
Artikelname: Anti-STAT1
Artikelnummer: ATA-HPA000931
Hersteller Artikelnummer: HPA000931
Alternativnummer: ATA-HPA000931-100,ATA-HPA000931-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ISGF-3, STAT91
signal transducer and activator of transcription 1, 91kDa
Anti-STAT1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6772
UniProt: P42224
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STAT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in non-germinal center cells.
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis using Anti-STAT1 antibody HPA000931 (A) shows similar pattern to independent antibody HPA000982 (B).
HPA000931-100ul
HPA000931-100ul
HPA000931-100ul