Anti-STAT1

Catalog Number: ATA-HPA000931
Article Name: Anti-STAT1
Biozol Catalog Number: ATA-HPA000931
Supplier Catalog Number: HPA000931
Alternative Catalog Number: ATA-HPA000931-100,ATA-HPA000931-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ISGF-3, STAT91
signal transducer and activator of transcription 1, 91kDa
Anti-STAT1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 6772
UniProt: P42224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STAT1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in non-germinal center cells.
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-STAT1 antibody. Corresponding STAT1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western blot analysis using Anti-STAT1 antibody HPA000931 (A) shows similar pattern to independent antibody HPA000982 (B).
HPA000931-100ul
HPA000931-100ul
HPA000931-100ul