Anti-DKC1
Artikelnummer:
ATA-HPA001022
- Bilder (6)
| Artikelname: | Anti-DKC1 |
| Artikelnummer: | ATA-HPA001022 |
| Hersteller Artikelnummer: | HPA001022 |
| Alternativnummer: | ATA-HPA001022-100,ATA-HPA001022-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKC, dyskerin, NAP57, NOLA4, XAP101 |
| dyskeratosis congenita 1, dyskerin |
| Anti-DKC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1736 |
| UniProt: | O60832 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DKC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. |
|
|
Western blot analysis in human cell line A-431. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG and human cell line A-431. |
|
|
HPA001022-100ul |
|
|
HPA001022-100ul |
|
|
HPA001022-100ul |
Produktgarantie und fachkundiger Support
