Anti-DKC1
Catalog Number:
ATA-HPA001022
- Images (6)
| Article Name: | Anti-DKC1 |
| Biozol Catalog Number: | ATA-HPA001022 |
| Supplier Catalog Number: | HPA001022 |
| Alternative Catalog Number: | ATA-HPA001022-100,ATA-HPA001022-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKC, dyskerin, NAP57, NOLA4, XAP101 |
| dyskeratosis congenita 1, dyskerin |
| Anti-DKC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 1736 |
| UniProt: | O60832 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DKC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center. |
|
|
Western blot analysis in human cell line A-431. |
|
|
Western blot analysis in human cell line RT-4, human cell line U-251 MG and human cell line A-431. |
|
|
HPA001022-100ul |
|
|
HPA001022-100ul |
|
|
HPA001022-100ul |
Product Guarantee and Expert Support
