Anti-YY1
Artikelnummer:
ATA-HPA001119
- Bilder (9)
| Artikelname: | Anti-YY1 |
| Artikelnummer: | ATA-HPA001119 |
| Hersteller Artikelnummer: | HPA001119 |
| Alternativnummer: | ATA-HPA001119-100,ATA-HPA001119-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ChIP, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1 |
| YY1 transcription factor |
| Anti-YY1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 7528 |
| UniProt: | P25490 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | YY1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity. |
|
|
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas moderate nuclear positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell line HL-60. |
|
|
HPA001119-100ul |
|
|
|
|
|
HPA001119-100ul |
|
|
HPA001119-100ul |
Produktgarantie und fachkundiger Support
