Anti-YY1

Catalog Number: ATA-HPA001119
Article Name: Anti-YY1
Biozol Catalog Number: ATA-HPA001119
Supplier Catalog Number: HPA001119
Alternative Catalog Number: ATA-HPA001119-100,ATA-HPA001119-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ChIP, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1
YY1 transcription factor
Anti-YY1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 7528
UniProt: P25490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: YY1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human lymph node shows strong nuclear positivity.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human pancreas moderate nuclear positivity in exocrine glandular cells.
Western blot analysis in human cell line HL-60.
HPA001119-100ul
HPA001119-100ul
HPA001119-100ul