Anti-COMT

Artikelnummer: ATA-HPA001169
Artikelname: Anti-COMT
Artikelnummer: ATA-HPA001169
Hersteller Artikelnummer: HPA001169
Alternativnummer: ATA-HPA001169-100,ATA-HPA001169-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
catechol-O-methyltransferase
Anti-COMT
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1312
UniProt: P21964
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: COMT
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and PC-3 using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001169-100ul