Anti-COMT Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001169
Article Name: Anti-COMT Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001169
Supplier Catalog Number: HPA001169
Alternative Catalog Number: ATA-HPA001169-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
catechol-O-methyltransferase
Anti-COMT
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 1312
UniProt: P21964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: COMT
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in human cell lines MCF-7 and PC-3 using Anti-COMT antibody. Corresponding COMT RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001169