Anti-STX17 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001204
Artikelname: Anti-STX17 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001204
Hersteller Artikelnummer: HPA001204
Alternativnummer: ATA-HPA001204-100,ATA-HPA001204-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ20651
syntaxin 17
Anti-STX17
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 55014
UniProt: P56962
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STX17
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
HPA001204
HPA001204
HPA001204