Anti-STX17 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-STX17 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001204
• Supplier Catalog Number: HPA001204
• Alternative Catalog Number: ATA-HPA001204-100,ATA-HPA001204-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: FLJ20651

Product Description

syntaxin 17

Additional Information

Anti-STX17

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 55014
• UniProt: P56962
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: STX17
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

HPA001204

HPA001204

HPA001204