Anti-STX17

Catalog Number: ATA-HPA001204
Article Name: Anti-STX17
Biozol Catalog Number: ATA-HPA001204
Supplier Catalog Number: HPA001204
Alternative Catalog Number: ATA-HPA001204-100,ATA-HPA001204-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ20651
syntaxin 17
Anti-STX17
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 55014
UniProt: P56962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STX17
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
HPA001204
HPA001204
HPA001204