Anti-PLEK2

Artikelnummer: ATA-HPA001208
Artikelname: Anti-PLEK2
Artikelnummer: ATA-HPA001208
Hersteller Artikelnummer: HPA001208
Alternativnummer: ATA-HPA001208-100,ATA-HPA001208-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PLEK2
pleckstrin 2
Anti-PLEK2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 26499
UniProt: Q9NYT0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PLEK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human liver and lymph node tissues using Anti-PLEK2 antibody. Corresponding PLEK2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
HPA001208-100ul
HPA001208-100ul
HPA001208-100ul