Anti-PLEK2
Catalog Number:
ATA-HPA001208
- Images (6)
| Article Name: | Anti-PLEK2 |
| Biozol Catalog Number: | ATA-HPA001208 |
| Supplier Catalog Number: | HPA001208 |
| Alternative Catalog Number: | ATA-HPA001208-100,ATA-HPA001208-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | PLEK2 |
| pleckstrin 2 |
| Anti-PLEK2 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 26499 |
| UniProt: | Q9NYT0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLEK2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human liver and lymph node tissues using Anti-PLEK2 antibody. Corresponding PLEK2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA001208-100ul |
|
|
HPA001208-100ul |
|
|
HPA001208-100ul |
Product Guarantee and Expert Support
