Anti-CBS

Artikelnummer: ATA-HPA001223
Artikelname: Anti-CBS
Artikelnummer: ATA-HPA001223
Hersteller Artikelnummer: HPA001223
Alternativnummer: ATA-HPA001223-100,ATA-HPA001223-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HIP4
cystathionine-beta-synthase
Anti-CBS
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 875
UniProt: P35520
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CBS
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles.
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
HPA001223-100ul
HPA001223-100ul
HPA001223-100ul