Anti-CBS Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CBS Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA001223
• Supplier Catalog Number: HPA001223
• Alternative Catalog Number: ATA-HPA001223-100,ATA-HPA001223-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HIP4

Product Description

cystathionine-beta-synthase

Additional Information

Anti-CBS

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 875
• UniProt: P35520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CBS
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles.

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.

Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

HPA001223

HPA001223

HPA001223