Anti-LYN

Artikelnummer: ATA-HPA001231
Artikelname: Anti-LYN
Artikelnummer: ATA-HPA001231
Hersteller Artikelnummer: HPA001231
Alternativnummer: ATA-HPA001231-100,ATA-HPA001231-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JTK8
LYN proto-oncogene, Src family tyrosine kinase
Anti-LYN
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4067
UniProt: P07948
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LYN
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-LYN antibody. Corresponding LYN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human cell line HEL.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001231-100ul
HPA001231-100ul
HPA001231-100ul