Anti-LYN Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001231
Article Name: Anti-LYN Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001231
Supplier Catalog Number: HPA001231
Alternative Catalog Number: ATA-HPA001231-100,ATA-HPA001231-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: JTK8
LYN proto-oncogene, Src family tyrosine kinase
Anti-LYN
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 4067
UniProt: P07948
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LYN
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-LYN antibody. Corresponding LYN RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Western blot analysis in human cell line HEL.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001231
HPA001231
HPA001231