Anti-PLOD3
Artikelnummer:
ATA-HPA001236
- Bilder (6)
| Artikelname: | Anti-PLOD3 |
| Artikelnummer: | ATA-HPA001236 |
| Hersteller Artikelnummer: | HPA001236 |
| Alternativnummer: | ATA-HPA001236-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LH3 |
| procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 |
| Anti-PLOD3 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 8985 |
| UniProt: | O60568 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLOD3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human appendix shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PLOD3 antibody. Corresponding PLOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
|
|
|
HPA001236-100ul |
|
|
HPA001236-100ul |
|
|
HPA001236-100ul |
Produktgarantie und fachkundiger Support
