Anti-PLOD3
Catalog Number:
ATA-HPA001236
- Images (6)
| Article Name: | Anti-PLOD3 |
| Biozol Catalog Number: | ATA-HPA001236 |
| Supplier Catalog Number: | HPA001236 |
| Alternative Catalog Number: | ATA-HPA001236-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LH3 |
| procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 |
| Anti-PLOD3 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 8985 |
| UniProt: | O60568 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLOD3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human appendix shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HEK293 using Anti-PLOD3 antibody. Corresponding PLOD3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
|
|
|
HPA001236-100ul |
|
|
HPA001236-100ul |
|
|
HPA001236-100ul |
Product Guarantee and Expert Support
