Anti-RPS6KA5
Artikelnummer:
ATA-HPA001274
- Bilder (6)
| Artikelname: | Anti-RPS6KA5 |
| Artikelnummer: | ATA-HPA001274 |
| Hersteller Artikelnummer: | HPA001274 |
| Alternativnummer: | ATA-HPA001274-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MSK1, RLPK |
| ribosomal protein S6 kinase, 90kDa, polypeptide 5 |
| Anti-RPS6KA5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9252 |
| UniProt: | O75582 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RPS6KA5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA001274-100ul |
|
|
|
|
|
HPA001274-100ul |
|
|
HPA001274-100ul |
Produktgarantie und fachkundiger Support
