Anti-RPS6KA5
Catalog Number:
ATA-HPA001274
- Images (6)
| Article Name: | Anti-RPS6KA5 |
| Biozol Catalog Number: | ATA-HPA001274 |
| Supplier Catalog Number: | HPA001274 |
| Alternative Catalog Number: | ATA-HPA001274-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MSK1, RLPK |
| ribosomal protein S6 kinase, 90kDa, polypeptide 5 |
| Anti-RPS6KA5 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 9252 |
| UniProt: | O75582 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RPS6KA5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells. |
|
|
Western blot analysis in human cell line SK-BR-3. |
|
|
HPA001274-100ul |
|
|
|
|
|
HPA001274-100ul |
|
|
HPA001274-100ul |
Product Guarantee and Expert Support
