Anti-USP14 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA001308
Artikelname: Anti-USP14 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA001308
Hersteller Artikelnummer: HPA001308
Alternativnummer: ATA-HPA001308-100,ATA-HPA001308-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TGT
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Anti-USP14
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9097
UniProt: P54578
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: USP14
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in human cell line U-251 MG.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001308
HPA001308
HPA001308