Anti-USP14

Catalog Number: ATA-HPA001308
Article Name: Anti-USP14
Biozol Catalog Number: ATA-HPA001308
Supplier Catalog Number: HPA001308
Alternative Catalog Number: ATA-HPA001308-100,ATA-HPA001308-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TGT
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Anti-USP14
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 9097
UniProt: P54578
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: USP14
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western blot analysis in human cell line U-251 MG.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001308-100ul
HPA001308-100ul
HPA001308-100ul