Anti-RAB27A

Artikelnummer: ATA-HPA001333
Artikelname: Anti-RAB27A
Artikelnummer: ATA-HPA001333
Hersteller Artikelnummer: HPA001333
Alternativnummer: ATA-HPA001333-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GS2, HsT18676, RAB27, RAM
RAB27A, member RAS oncogene family
Anti-RAB27A
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5873
UniProt: P51159
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RAB27A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and skeletal muscle tissues using HPA001333 antibody. Corresponding RAB27A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells with additional stron membranous positivity in a subset of glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-RAB27A antibody. Corresponding RAB27A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA001333-100ul
HPA001333-100ul
HPA001333-100ul