Anti-RAB27A Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001333
Article Name: Anti-RAB27A Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001333
Supplier Catalog Number: HPA001333
Alternative Catalog Number: ATA-HPA001333-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GS2, HsT18676, RAB27, RAM
RAB27A, member RAS oncogene family
Anti-RAB27A
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 5873
UniProt: P51159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RAB27A
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human stomach and skeletal muscle tissues using HPA001333 antibody. Corresponding RAB27A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells with additional stron membranous positivity in a subset of glandular cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Western blot analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-RAB27A antibody. Corresponding RAB27A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HPA001333
HPA001333
HPA001333