Anti-LIG4
Artikelnummer:
ATA-HPA001334
- Bilder (7)
| Artikelname: | Anti-LIG4 |
| Artikelnummer: | ATA-HPA001334 |
| Hersteller Artikelnummer: | HPA001334 |
| Alternativnummer: | ATA-HPA001334-100,ATA-HPA001334-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LIG4 |
| ligase IV, DNA, ATP-dependent |
| Anti-LIG4 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 3981 |
| UniProt: | P49917 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LIG4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells and smooth muscle. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
HPA001334-100ul |
|
|
HPA001334-100ul |
|
|
HPA001334-100ul |
Produktgarantie und fachkundiger Support
