Anti-LIG4
Catalog Number:
ATA-HPA001334
- Images (7)
| Article Name: | Anti-LIG4 |
| Biozol Catalog Number: | ATA-HPA001334 |
| Supplier Catalog Number: | HPA001334 |
| Alternative Catalog Number: | ATA-HPA001334-100,ATA-HPA001334-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LIG4 |
| ligase IV, DNA, ATP-dependent |
| Anti-LIG4 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 3981 |
| UniProt: | P49917 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LIG4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong nuclear positivity in glandular cells and smooth muscle. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubules. |
|
|
HPA001334-100ul |
|
|
HPA001334-100ul |
|
|
HPA001334-100ul |
Product Guarantee and Expert Support
